01
Telomere Biology
Investigated in cell-culture models of telomere maintenance and replicative ageing.
← Back to catalog
Immune Research
In stockLL-37
LL-37 is a human cathelicidin antimicrobial peptide studied for its role in innate immune signaling and host defense pathway research [1,2] .
Professional pricing
Sign in or create a research account to see prices and add this material to your order. Access unlocks as soon as you create your account.
Sign in for pricing- In stock — ready to ship
- Controlled handling
Specifications
Product & molecular data
Lot & handling
- SKU
- SR-2237
- Category
- Immune Research
- Storage
- -20 °C, sealed, protected from light
- Availability
- In stock
Molecular
- Sequence
- [LL-37, 37 aa]
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.26 g/mol
- CAS number
- 154947-66-7
- Storage conditions
- −20 °C sealed and desiccated, protected from light
- Format
- Lyophilized Vial
Analytics
Testing & quality
When a lot certificate is on file we report identity, purity, and appearance. We publish analytical data only — never dosing information or outcome claims.
01
RP-HPLC
Chromatographic purity against a qualified reference standard.
02
LC-MS / ESI-MS
Identity by observed versus theoretical molecular mass.
03
Karl Fischer / Loss on Drying
Residual moisture in lyophilized material.
04
Endotoxin & Bioburden
Contaminant screening on raw material and finished lots.
Research background
Published research context
Summary of the published literature this reference material is used in.
02
Gene Expression
Studied for reported effects on transcriptional regulation in experimental systems.
03
Senescence Models
Referenced in literature examining cellular senescence markers in vitro.
Innate Immune Signaling
LL-37 is examined for its interaction with microbial membranes and immune signaling receptors [1].
Inflammation and Host Defense
Studies explore LL-37’s role in chemotaxis, cytokine modulation, and barrier defense signaling [2].
Peptide Structure and Function
Its amphipathic structure supports studies of membrane interaction and immune pathway activation [1].
Key Specs
- Peptide class: cathelicidin
- Research context: innate immunity
- References: PubChem, PubMed [1,2]
Referenced Citations
- PubChem, LL-37: https://pubchem.ncbi.nlm.nih.gov/compound/LL-37
- PubMed, Cathelicidin LL-37: https://pubmed.ncbi.nlm.nih.gov/12612294/
Related compounds
In stock
In stock
In stock
